SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_00952 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290339.ESA_00952
Domain Number 1 Region: 106-306
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-50
Family D-glucarate dehydratase-like 0.0000000553
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.89e-26
Family Enolase N-terminal domain-like 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_00952
Sequence length 321
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MRAAQLYRYQVPMDAGVVLRERRLKTRDGLLVRLSDNGREGWGDIAPLPGFSDETLDAAL
SAARDWLRAWQRGDAQPLPEVASVAFGLSMAQAELHGTLPVAANYHTAPLCTGDPDELFA
RLAGLTGKKVAKVKVGLYEAVRDGMVVNLLLEAIPDLTLRLDANRAWTPLKAQQFAKYVN
PAYRSRIEFIEEPCKTPDDSRAFAAETGIAIAWDESLRERDFSITAEPGLRAVIIKPTLT
GSLQTVQQQVAQAHAQCLTAVISSSIESSLGLTQLARLAAWLTPGVTPGLDTLALMQAQL
VRPWPGSPLPCWPVDALEPLL
Download sequence
Identical sequences A7MHT1
gi|156933142|ref|YP_001437058.1| 290339.ESA_00952 WP_012124169.1.26514 WP_012124169.1.34712 WP_012124169.1.42482 WP_012124169.1.4622 WP_012124169.1.52367 WP_012124169.1.56053 WP_012124169.1.60338 WP_012124169.1.61601 WP_012124169.1.67391 WP_012124169.1.83282 WP_012124169.1.84694 WP_012124169.1.9447 WP_012124169.1.95648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]