SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_03584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290339.ESA_03584
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000883
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_03584
Sequence length 100
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MSAELHWERQEAQLRLNGTLDRETLTPLWEQRQSITDGLQRIDLSGLERVDTAGLALLVH
LVALTQAGGRGVTLEGMSENLTTLAKLYNLPENLLPITTD
Download sequence
Identical sequences A7MNS4
WP_004385082.1.100123 WP_004385082.1.10743 WP_004385082.1.14450 WP_004385082.1.15880 WP_004385082.1.19250 WP_004385082.1.21817 WP_004385082.1.22106 WP_004385082.1.22333 WP_004385082.1.2234 WP_004385082.1.22982 WP_004385082.1.26514 WP_004385082.1.2805 WP_004385082.1.28222 WP_004385082.1.29051 WP_004385082.1.2985 WP_004385082.1.30214 WP_004385082.1.30537 WP_004385082.1.34134 WP_004385082.1.34426 WP_004385082.1.34483 WP_004385082.1.34712 WP_004385082.1.360 WP_004385082.1.3715 WP_004385082.1.37173 WP_004385082.1.38143 WP_004385082.1.38225 WP_004385082.1.39049 WP_004385082.1.39764 WP_004385082.1.40036 WP_004385082.1.42482 WP_004385082.1.46181 WP_004385082.1.4622 WP_004385082.1.48882 WP_004385082.1.4995 WP_004385082.1.50354 WP_004385082.1.50864 WP_004385082.1.51998 WP_004385082.1.52367 WP_004385082.1.54721 WP_004385082.1.56053 WP_004385082.1.56561 WP_004385082.1.57355 WP_004385082.1.57820 WP_004385082.1.58258 WP_004385082.1.59680 WP_004385082.1.60338 WP_004385082.1.6095 WP_004385082.1.61601 WP_004385082.1.62753 WP_004385082.1.63198 WP_004385082.1.63385 WP_004385082.1.6429 WP_004385082.1.67106 WP_004385082.1.67166 WP_004385082.1.67391 WP_004385082.1.69145 WP_004385082.1.72500 WP_004385082.1.73174 WP_004385082.1.75231 WP_004385082.1.78906 WP_004385082.1.83282 WP_004385082.1.84694 WP_004385082.1.88335 WP_004385082.1.88549 WP_004385082.1.90098 WP_004385082.1.90251 WP_004385082.1.91115 WP_004385082.1.92451 WP_004385082.1.93037 WP_004385082.1.93581 WP_004385082.1.9447 WP_004385082.1.94763 WP_004385082.1.95253 WP_004385082.1.95290 WP_004385082.1.95648 WP_004385082.1.98129 WP_004385082.1.98221 WP_004385082.1.99856 gi|156935715|ref|YP_001439631.1| 290339.ESA_03584 gi|449309830|ref|YP_007442186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]