SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290339.ESA_pESA3p05473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290339.ESA_pESA3p05473
Domain Number 1 Region: 152-428
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-68
Family D-glucarate dehydratase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 55-165
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.02e-29
Family Enolase N-terminal domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290339.ESA_pESA3p05473
Sequence length 448
Comment (Enterobacter sakazakii ATCC BAA-894)
Sequence
MVKLVWFIGAFKKKLLTKINSQKKGLPAIIFKVMILTFRISIALQRSDFVTPVNIKNIEC
FITRPDRHNLVTVRVTTDQGVTGHGCATFQQRPLAVKTLVEEYLQPLLTGRDANNIEDLW
QMMNVNAYWRNGPVMNNAISGVDMALWDIKSQLAGMPLYQLFGGKSRDAIPAYSHASGDT
LDALFASVDALIEQGYRHIRCQLGFYGGTPSGLHAPENPTPGAWFDQQEYMRNTVDMFRA
LREKYGWSLHFLHDVHERLFPQQAIQLAKQLEPYQPYFIEDILPPQQSAWLEQVRQHSCV
PLAMGELFNNPSEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGD
MTPIGVAVNTHLNIHLHNAAIQEFIPRSAMTDRVFPGAPEVKDGFIYPPVNAGIGVGFNE
ALAQAHPVMYRPHEWTQSRLPDGTLHTP
Download sequence
Identical sequences A0A222ZDI1 A7MRH0
gi|156936592|ref|YP_001440506.1|NC_009780 gi|156936592|ref|YP_001440506.1| 290339.ESA_pESA3p05473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]