SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_2191 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_2191
Domain Number 1 Region: 100-160
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000114
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_2191
Sequence length 168
Comment (Arthrobacter aurescens TC1)
Sequence
MTVIPLAGSGTKGEMMFEWLGENWWALWLTVFLAFSVVEMLTLDLFFIMLGGGALAGLIA
DFAGADFWLQIVIFSVVSLLMIVFVRPVAMKHLHKGPAEQRSNIDRLIGQSALVIEAVSG
TSGLVKIGGDVWSARSTAGVLDAGSTVQVTRIDGATAVVASSAENSPR
Download sequence
Identical sequences A1R6S1
gi|119960574|ref|YP_947933.1| 290340.AAur_2191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]