SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_3584 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_3584
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.64e-53
Family TK-like Pyr module 0.0054
Further Details:      
 
Domain Number 2 Region: 174-307
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.7e-28
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_3584
Sequence length 310
Comment (Arthrobacter aurescens TC1)
Sequence
MKAQRDVWGQTLVDLARTDSRVAVVDGDLATSTKADLFADAFPDRFFEIGIAEQNMVGVA
FGLSTLGFRPWLSTFGVFLTHRALDPIRMLVSQTGAPVKIAASYSGLLNGSSGKTHQDIE
DLAIMRAMPGMTVIAPADAIEAEAAIRWAADHDGPVYLRLARDAVSDIFSPGHAFTPGTV
HVLREGNDALLVSTGVQSSRVMDAAALLAEEGIEARVVHVPCLKPVDEAALLSALSGPAP
IFTIEEHSIIGGLGGLVSELVTSTTLGKTVTRLGLADAWSESAPNSYLLDKYGLSPARVA
GQVRHALADD
Download sequence
Identical sequences A1RAL4 J7LYA0
gi|403528743|ref|YP_006663630.1| APC66022.0 gi|119962136|ref|YP_949276.1| WP_011776202.1.27003 WP_011776202.1.67142 WP_011776202.1.83037 290340.AAur_3584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]