SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290340.AAur_3801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290340.AAur_3801
Domain Number 1 Region: 184-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-69
Family D-glucarate dehydratase-like 0.0000000149
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.72e-42
Family Enolase N-terminal domain-like 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290340.AAur_3801
Sequence length 434
Comment (Arthrobacter aurescens TC1)
Sequence
MSIITAVDTFDIRFPTSLELDGSDAMNPDPDYSAAYLIIRTDAGDGHEGHGFVFTIGRGN
EVETAALDALRGHILGRDVETLLDDMGATWKLLAHDSQLRWLGPEKGVMHMAIGAVVNAL
WDLKAKRAGLPLWELLAGMTPEELVALVDFRYLTDALTPDEALTILRAAQPGRETRTATL
RADGYPAYTTTPGWLGYSDEKLTRLAKEAVADGFAQIKLKVGASLEDDIRRVRTARAAVG
PDIKIAVDANQRWDVQQAIDWMAHLAPYHIAWIEEPTSPDDILGHAAIARGVAPIPVATG
EHVQNRVVFKQMLQAGSLQVLQIDAARVAGVNENIAILLLAAKFGVRVCPHAGGVGLCEA
VQHLSMFDYIAVSGTKEGRTIEFVDHLHEHFITPVVVHDGAYWPPAAPGAGNEMLRETLA
AYSFPNGPIWKEPR
Download sequence
Identical sequences A1RB69
290340.AAur_3801 WP_011776406.1.67142 gi|119964158|ref|YP_949481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]