SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290397.Adeh_0880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290397.Adeh_0880
Domain Number 1 Region: 75-138
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000562
Family NfeD domain-like 0.0095
Further Details:      
 
Weak hits

Sequence:  290397.Adeh_0880
Domain Number - Region: 5-78
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00183
Family ABC transporter transmembrane region 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290397.Adeh_0880
Sequence length 140
Comment (Anaeromyxobacter dehalogenans 2CP-C)
Sequence
MDWWMWVLAGIGLLVVELVTPGGLFALFFGVGALVVAPAAAAGLGRVGQWLLFTAVSLVL
LATLRRRLQDRLTRRPGAPVDSLVGEEVVLLGDVPAGGEGAAELRGVPWRARAVGGDTLR
AGQRCRVERVEGVLLWVRAA
Download sequence
Identical sequences Q2IPC0
gi|86157307|ref|YP_464092.1| 290397.Adeh_0880 WP_011419938.1.3732 2005419399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]