SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290398.Csal_1525 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290398.Csal_1525
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.88e-44
Family GHMP Kinase, N-terminal domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 160-282
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.25e-29
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290398.Csal_1525
Sequence length 298
Comment (Chromohalobacter salexigens DSM 3043)
Sequence
MQRLSLPAPAKLNRMLHIVGRRADGYHELQTLFQFLDRSDTLHFSPRADGAIHLAPAIAD
VDHDANLIVRAARLLQHASGTHQGVDIHLDKRLPMGGGLGGGSSDAATTLLALDRLWSLD
LGLPRLAELGLTLGADVPVFVRGHSAWAEGIGERLTPVTLDTPWFVVIHPGEEIATPAVF
GHPELTRDTPPISMARALRGGAEQGRAWRNDCEAVVRRLSPDVAHALDWLSAFGPAMLTG
TGSCLFCPLTSERQADRILRRVGSHWHAFKARGCNTSPLHDALGIHDEWSPMSQYGDA
Download sequence
Identical sequences Q1QXD0
WP_011506824.1.10555 gi|92113649|ref|YP_573577.1| 290398.Csal_1525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]