SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290398.Csal_2216 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290398.Csal_2216
Domain Number 1 Region: 15-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000179
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290398.Csal_2216
Sequence length 114
Comment (Chromohalobacter salexigens DSM 3043)
Sequence
MSVLLEREGARLEVCQERILKVDGEADFDSAASLAAKGTEWLQGLPRATEVEFDLTGVQR
ASSAVLSVLLEWLRTAQACEVHIVQVTLSQPLARLTAMAGLDPLLPTAETSVSA
Download sequence
Identical sequences Q1QVE1
WP_011507513.1.10555 WP_011507513.1.81366 2005430279 gi|92114338|ref|YP_574266.1| 290398.Csal_2216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]