SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290398.Csal_2486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290398.Csal_2486
Domain Number 1 Region: 134-391
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-75
Family D-glucarate dehydratase-like 0.00000346
Further Details:      
 
Domain Number 2 Region: 3-134
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.05e-20
Family Enolase N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290398.Csal_2486
Sequence length 422
Comment (Chromohalobacter salexigens DSM 3043)
Sequence
MSCISSVVVTPIAFRDPPLLNVSGVHEPWALRSIIEVTIEDGRYGLSESYGDEQTLSQLQ
TVASHLVGVDVFHLNELKSIVEASVSHKSQENGIELAPGTNQATTVPRIFAAFEVAFLDL
MGKITERSVCDLLGGKVRDAVPYSAYLFYKYGHHQFSQDDWVDAWGEVLTPEDIVRSARQ
MIDQYGFQSIKLKGGVFEPEQELLAVRALREAFPEYPLRIDPNGGWTPETTRRLLPQMEG
VLQYLEDPASGKDSMAEVHRSATMPLATNMCVIGFFDFPEAIAKQSVDVILSDHHYWGGL
QATRELARVCETWGLGLSMHSNSHLGISLMAMTHAAAAIDNLTYACDTHYPWQEEEVIVG
GKVSFEEGSVRVPDAPGLGVELDRDALQKLARNFQECGIRSRNDVKEMQKYDPSWTGKVP
RF
Download sequence
Identical sequences Q1QUM5
WP_011507779.1.10555 gi|92114604|ref|YP_574532.1| 290398.Csal_2486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]