SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290398.Csal_2767 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290398.Csal_2767
Domain Number 1 Region: 43-218
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.07e-23
Family Clp protease, ClpP subunit 0.035
Further Details:      
 
Domain Number 2 Region: 390-454
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000549
Family NfeD domain-like 0.0029
Further Details:      
 
Weak hits

Sequence:  290398.Csal_2767
Domain Number - Region: 278-384
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00889
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290398.Csal_2767
Sequence length 464
Comment (Chromohalobacter salexigens DSM 3043)
Sequence
MRWHSEALARRRYLLWACLLMVGLGLSWWASAQSERDASLGVVLSIDGSIGPATSDYFQR
GLERAEEAGASLVILELDTPGGLDAAMRDMIGAMLASPIPVVSYVSPAGSRAASAGTYLL
YASHVAAMALATHLGSATPVQLGGGGGESAPDEAQEGDAQETSSSAMERKVLEDAVATIR
SLAERHGRNAQWAERAVREAANLTASEALEANVIEIVASDLDDLLTQLDGRRVVMDDGER
TLSTQGMALERQPPDWRAQVLAVITDPNVAYFLMIVGFYGLIFELLSPGTLFPGVIGAIC
LVLAMYAFQVLSVGYAGLVLVFLGMALVVAEAFVPSIGVLGFGGLAAFVAGSVMLMDDTH
QRLALPMVGGIALIAAGFLLWVVMRFLSVQRHRPQGGQEELVGQVATVLAGFEVQGKVMV
HGERWRARCSRRLARGQQVRIVAVDGLTLMVEPLTETPQASDGA
Download sequence
Identical sequences Q1QTU4
WP_011508060.1.10555 gi|92114885|ref|YP_574813.1| 290398.Csal_2767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]