SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_0504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_0504
Domain Number 1 Region: 98-393
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.01e-72
Family D-glucarate dehydratase-like 0.00056
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-34
Family Enolase N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_0504
Sequence length 409
Comment (Arthrobacter FB24)
Sequence
MKIIAAEVFVTSPSRNFVTLRITTEDGVTGIGDATLNGRELAVAAYLKEHVAQLLIGKDP
HRIEDTWQFLYRSSYWRRGPVTMAAIAAVDMALWDIKGKVAGLPVYQLLGGASRNGLRAY
GHASGSDIPSLFDSVREHLELGYKSIRIQTAVPGIKAVYGVAAQAQASGERYDYEPAGRG
TFPLEEDWDTRAYLRHLPTVFEAVRNEFGPEIPLLHDGHHRMTPIQAAKLGKALEPYDLF
WLEDCTPAENQEGLRLVRQHTTTPLAIGEVFNTVYDFQTLIKEQLIDYVRAASTHFGGIS
PLKKVMDFAAQYQIKSGFHGPTDISPVGFAAQLHVGLAIHNYGIQEYMQHSDKTNEVFEQ
SMTFVDGYLHPGDKPGIGVEFNAEAAAAYPYQQAYLPYNRLVDGTVHDW
Download sequence
Identical sequences A0JS83
290399.Arth_0504 gi|116669070|ref|YP_830003.1| WP_011690372.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]