SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_2155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  290399.Arth_2155
Domain Number - Region: 36-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00173
Family Sfri0576-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_2155
Sequence length 123
Comment (Arthrobacter FB24)
Sequence
MTNSTEANVCVGHIREGVSRITLRPGARVTEEDGIRTREQLLALTGGARGGVLLDITGVG
SVSREAIRVYSSAATVSAFAILGSTPVDRVIAHGLLGLPLPACPSEYFTDEDEALNWLQS
VTG
Download sequence
Identical sequences A0JWW5
290399.Arth_2155 gi|116670702|ref|YP_831635.1| WP_011692001.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]