SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_2190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_2190
Domain Number 1 Region: 85-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000654
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_2190
Sequence length 153
Comment (Arthrobacter FB24)
Sequence
MFEWLGENWWALWLTVFLAFAVVEMLTLDLFFIMLGGGALAGLLADFAGADFWLQIVVFC
VVSLLMVVFVRPVALKHLKKGPAEQRTNIDRLIGESALVMETVSTSSGLVKIGGDVWSAR
SENGVLNAGQRVVVSAIEGATAVVAPQPETAVQ
Download sequence
Identical sequences A0A0D1AVH6 A0JX00
290399.Arth_2190 gi|116670737|ref|YP_831670.1| WP_011692036.1.18317 WP_011692036.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]