SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_2329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_2329
Domain Number 1 Region: 448-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_2329
Sequence length 563
Comment (Arthrobacter FB24)
Sequence
MRRDWILKAVPGIQLARTYQRSWLQPDLAAGAALSAALIPAGMAYAEAAGLPAITGLYAS
VVPMLFYAVFGPARVIIVGPDSSLAPMIAAAVLPLAGRDPDHAVALAGVLAILIGIFLVA
GRIFRLGFVTGLLSKPIRVGYLNGIALAIMVSQLPRLLGITVSGDSLPARATETAEAVVG
GATNPVALLFGAATVAIIVAGRFLPGKVPGVLLAVGASIAAAAALDLRDAMPMVGALPSG
LPKPALEGVTMEDVAGLIGPAAGIALIAFADTSALSKSLAGRRGIHTSGNQEMGALGIAN
VASGMLGGFPVCGSSSRTPIALDAGARTPFSGIVAAALVVVFMVAAPGVTAYLPTTTLAA
VVMVAAASLVDIKTLLRLVRMSRMETVLLVATFLGVAFVGVLQGIVIAISLSLIAFIRRA
WDPYRTELASLEDIPGYHDLSRHPEGKRVPGLVIARFDAPLFFANGAVFAEHIRNLVANA
PAPVKWVIVAAEAITDLDTTALDDLVELDDELAGQGISLVFAELKGPVKDRLLRFGVSSR
FGPDHFFPTVNNAVRTYKRTFGI
Download sequence
Identical sequences A0JXD9
WP_011692173.1.37281 gi|116670876|ref|YP_831809.1| 290399.Arth_2329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]