SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290399.Arth_3029 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290399.Arth_3029
Domain Number 1 Region: 433-538
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.29e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290399.Arth_3029
Sequence length 549
Comment (Arthrobacter FB24)
Sequence
MRTLRAFLPSRRDYDGLRSSWKTDLTAGITVGIVALPLALAFGVSSGVGAEAGLITAVVA
GLVAAIMGGSNVQVSGPTGAMVVVLAPVVASHGAGSIPIVSLLAGLIVCALGISGLGRAV
AFIPWPVVEGFTLGIAAIIFLQQVPLATGTAGIPGHNTLVAAIEAASGAAFPTVIQTLAV
VVAVAAIMFVVPKVHKSLPASLTAVLLVTVAAELLRLDIPRIGALPHSLPAPAVPMIDPT
ALGDLMMPALSIAALAAIESLLSARVAAGMVGPDGRPGGRYSPDRELTGQGLASIAAGLF
GGMPATGAIARSAVNVRSGAKTRLAAVVHALVLLAIIYLAAGLVGRIPLAVLGGVLMVTA
TRMVSTQTVSAILRSTRSDAAVFILTALITVAFDLIIAIQIGLAAAALLTLRKFASLSGV
RREALTGAPAEGDSHIAIFRLDGAMFFGAAERILQEINEVKDIQVAIIRLSQVRMLDATG
AHALVEVISALELRGITVLLKGVQPEHLELVTNVGVIRSLRHHKHLFSTLPAAVDHARSH
VLRNAAASA
Download sequence
Identical sequences A0JZD8
290399.Arth_3029 WP_011692860.1.37281 gi|116671575|ref|YP_832508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]