SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290400.Jann_0432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290400.Jann_0432
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily YccV-like 9.81e-36
Family YccV-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290400.Jann_0432
Sequence length 108
Comment (Jannaschia CCS1)
Sequence
MLETQAKYNIGQIVKHRKHPFRGVVFDIDAEFSNSDEWYEAIPEDARPLKDQPFYHLLAE
NDQTYYVAYVSEQNLVPDDTGEPVTHPDLPDLFGEFSNGHYPLEYQLN
Download sequence
Identical sequences Q28VB3
WP_011453558.1.50977 290400.Jann_0432 2005321483 gi|89052923|ref|YP_508374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]