SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290400.Jann_4051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290400.Jann_4051
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290400.Jann_4051
Sequence length 115
Comment (Jannaschia CCS1)
Sequence
MNLTYTPHITVGVVHLADSRLDASIAIQFKETFRTLTADGGDVILDLTDVEFLDSSGLGA
IVAVYKGLGPGRHMALAGLQPPVEKVMTLTRMNAVFAIFPTLDAGLAAIGPTAAE
Download sequence
Identical sequences Q28JZ4
WP_011457164.1.50977 gi|89056542|ref|YP_511993.1| 290400.Jann_4051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]