SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_1045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_1045
Domain Number 1 Region: 82-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000693
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_1045
Sequence length 143
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MGAAVFWLVIAICVFAIDILTSNFCFTLFAVGAVVAAVCGVMEVPFIIQIIVFSVLNIIS
FAVGYPLLKKKFKAANERIPLMEETYVGKIMISEKEIIDKAQVKVGGEYWTVINEGDIIH
KGDKFTIKGIEGIKLKIEKVQED
Download sequence
Identical sequences A0A0K2MIJ5 A0A1S8QPX1 A6LS99
gi|150015931|ref|YP_001308185.1| WP_011968388.1.16915 WP_011968388.1.44456 WP_011968388.1.51202 WP_011968388.1.88565 WP_011968388.1.91641 WP_011968388.1.95078 WP_011968388.1.96201 290402.Cbei_1045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]