SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_1197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_1197
Domain Number 1 Region: 261-347
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000036
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 10-208
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.0000000000018
Family Dihydropteroate synthetase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_1197
Sequence length 359
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MERRKSRKVKVGNVFVGGDSPVTVQSMTNTRTKDVENTLNQIEKLYSAGCDIIRCAVLDM
EDAESLGEITKRSPIPVVADIHFDYKLALKAIENGVSALRINPGNIGSVDRIKILKEACS
EKKIPIRIGVNSGSLEKDILEKYGMPTAEGLVESALRHVKILEDLDFHDIVISIKSSSVQ
MMIECYRLIAEKCDYPLHLGVTEAGTIQRGTIKSSIGIGTLLAEGIGDTIRVSLTTDPIE
EIKVGIEILKALGLRKKGVEFVSCPTCGRTQINLIKIAEEVEKRLENYKKDIKVAVMGCV
VNGPGEARESDIGIAGGKGEGIIFKKGEIIKKVKEEDLIDALMEEIEKLCTDEDGAEHN
Download sequence
Identical sequences A6LSP9
WP_011968534.1.16915 WP_011968534.1.44456 WP_011968534.1.51202 WP_011968534.1.88565 WP_011968534.1.91641 290402.Cbei_1197 gi|150016081|ref|YP_001308335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]