SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_1483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_1483
Domain Number 1 Region: 98-163
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000366
Family NfeD domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_1483
Sequence length 165
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MSAFLPDVTVLTVLLLVVGFGLVLLEMHIPGFGVPGIAGAICLILAVVLTAENFAQALVM
ILGILAILGIMLGVVLTFFTKGKFFKPLILPDEQKKEHGYISSSDLDYLLGKSGVAVTDL
RPTGSVDIDGVKFDVISEGEYINKGTNVEIFKVSGVKLLVKKVKI
Download sequence
Identical sequences A0A1S8P5M6 A6LTI1
290402.Cbei_1483 WP_011968813.1.2274 WP_011968813.1.27559 WP_011968813.1.33930 WP_011968813.1.41106 WP_011968813.1.44456 WP_011968813.1.51202 WP_011968813.1.88565 WP_011968813.1.91641 2005431661 gi|150016363|ref|YP_001308617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]