SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290402.Cbei_1853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290402.Cbei_1853
Domain Number 1 Region: 790-1169
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.95e-128
Family PFOR PP module 0.00000000453
Further Details:      
 
Domain Number 2 Region: 415-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.37e-86
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000771
Further Details:      
 
Domain Number 3 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.21e-75
Family PFOR Pyr module 0.0000000206
Further Details:      
 
Domain Number 4 Region: 258-412
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000239
Further Details:      
 
Domain Number 5 Region: 670-834
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.11e-19
Family Ferredoxin domains from multidomain proteins 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290402.Cbei_1853
Sequence length 1171
Comment (Clostridium beijerinckii NCIMB 8052)
Sequence
MRKMKTMDGNTAAAYMSYGFSEAAVIFPITPSSPMAEHVDEWVAQGKKNIFGQPLKVVEM
QSEAGAAGALHGSLQAGALTTTYTASQGLLLMIPNMYKIAGELLPCVIHVAARALATSAL
SIFGDHQDVMAARQTGFAMLAEGSVQEVMDLSGVAHLATIKSRIPFMNFFDGFRTSHEIQ
KIEVIEPEELVKVLDYKALDEFRKRALNPNHPVIRGTAQNQDIYFQMREAVNKYYDDVPE
IVEQYMTEITRLTGRSYHCFDYYGAHDADRIIISMGAVNDVIEETVDFLNNNKQRVGLVK
VRLYRPFSVDKLLKAIPKTVRKIAVLDRTKEPGSVGEPLYLDVSRAFFGMDNAPIVVGGR
FGLGSKDPTPAHIAAVYDNLFLDVPKNNFTIGIIDDVTNTSLRTFEHIDATPDGITSCKF
WGLGSDGTVGANKSAIKIIGDNTDMYAQGYFDYDSRKSGGLTVSHLRFGDKPIKSRYPID
RPDFVACHNQSYVYKYHVIRGLKKNGKFILNTIWTPEELDERLPASIKRYIAQNHIEFYI
INAVKIAQDVGLGGRINMIMQAAFFKIANIIPVEDAIKFLKEAVVKSYGNKGEKIVNMNH
AAIDAGLEGITKIKVPYSWNTDLDDKLELDENFPEFIKEITRPMNRLEGDSMPVSHFVKA
GIQDGTFMSGTTSYEKRGIAVNVPEWIPENCIQCTQCSYICPHATIRAFLLNEDEKEKAP
ESLKVLDSKGIKGDEKLYFSIGVTPLDCTGCGNCAQVCPAPGKALVIKSQDSQHEQIEAW
NYYMERVKPKNPLNKYTLKGSQFERPLLEFNGACAGCGETPYARLVTQLFGDRMMIANAT
GCSSIWAAGSYEMAYTINEHGHGPAWANSLFEDNAEFGYGMYLGVKTIRERIANNVTIAL
ESNMSEETKTVLREWLDNKDIGDGTRERAKRLVEVLEKENSEISKEILKDREYFVKRSQW
IFGGDGWAYDIGYGGLDQVIAMNENVNILVFDTEIYSNTGGQSSKSTPTAAIAKFAASGK
RTKKKDLGRMAMTYGYVYVAQVCMGADKNQTIKAITEAEAYDGPSLIIAYSTCINHGIKV
GMSNTQEEEKKAVDCGYWHLYRYNPALKGEKNPFILDSKDPKEDFKDFLMGEVRYASLAK
AFPEESEKLFEKTESEAKERLEIYKTLANQQ
Download sequence
Identical sequences A6LUJ4
290402.Cbei_1853 WP_011969176.1.44456 WP_011969176.1.51202 WP_011969176.1.88565 WP_011969176.1.91641 gi|150016726|ref|YP_001308980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]