SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290512.Paes_0871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290512.Paes_0871
Domain Number 1 Region: 36-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.17e-30
Family Clp protease, ClpP subunit 0.016
Further Details:      
 
Domain Number 2 Region: 378-437
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000222
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290512.Paes_0871
Sequence length 444
Comment (Prosthecochloris aestuarii DSM 271)
Sequence
MFVIKKISVFIFTVFVLFLSVTVTHKDVHGDNGQSVLYTISLQGSINPGSADFFDRAVSL
AIADSAHAVLVELDTPGGLVTSLRQMVRRIMASSVPVIVYVAPRGAQAASAGALLTLASH
VAAMSPGTEIGAAHPVGLGGGESEKSGVMSQKAVNDLAAFARSLAEERGRSPVWAEKAVR
ESIASTANEAFEAGVIDVVADDRTTLFKALEGRVVQTADRSVTLSLVSAELRELSPTFQE
QVLMKLADPNLAYIFIMVGLVGLYFELANPGAIFPGVAGAISLLLGLFALQALPVNIVGL
LLLALSVIFLGLEVFVTSGGVLAISGLISLLVGSLMLFNTPETGVSLSLFVFLPVFIGVS
IITLTIVWLVARSAMGAPLSGSEQLSGTEGRVVRAIGPGVTGKVFVHGELWDAESAESLP
ENAPVTVSGLKGMVLQVISKKESV
Download sequence
Identical sequences B4S779
290512.Paes_0871 gi|194333703|ref|YP_002015563.1| WP_012505453.1.66998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]