SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290512.Paes_1455 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290512.Paes_1455
Domain Number 1 Region: 200-448
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.39e-61
Family PFOR Pyr module 0.069
Further Details:      
 
Domain Number 2 Region: 8-218
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.036
Further Details:      
 
Domain Number 3 Region: 467-564
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000314
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 290512.Paes_1455
Sequence length 566
Comment (Prosthecochloris aestuarii DSM 271)
Sequence
MPHYSDDLSIAFGGAAGQGIQTIVGALVDVLRKNDYHVFACNEFMSRVRGGSNSSMVRVT
KEKRSAYLKRIDLLFILQPDALEHLRDRIGDTTLIFAEKKLLSPADAKLVIDAPLGALAE
KAGSSIFTNTVAVGVVLGVLGLPLERFEHYLAEQFEHKGPDTVSKNIESARLGYDFGVRT
AREMEISVDLPDAAGEPASLLINGSNAVGIGAVAAGCDIITSYPMSPGTGLLTFLAKHSD
KFGIIVDQSEDEIAAINAALGASYAGARAVVTTSGGGFALMGEGLSLSGIMELPVVIHVG
QRPGPATGLPTRTEQGDLNLVLYAGHGDFSRAIFAPGTFAQAADVMQRAFALADRFQIPV
VVLTDQFFLDSYTTVPEAAMQRMAVERSLVRTTSDYERYSLTADGLSPRSVPGYGEGVVK
VDSHEHDTTGHLTENTVLRERMVEKRLARLRPLAEEALMPAQFGNVEAPVVLVCWGSNYG
VVKEALDIVGSSDLSGMHFSQLYPLNPALRDLLDHKRVLVLENNATGQFADLLQRELGIT
ADRRIGKVSGEPFAVEEVVQMLKEEL
Download sequence
Identical sequences B4S8T8
gi|194334262|ref|YP_002016122.1| WP_012506008.1.66998 290512.Paes_1455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]