SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 290633.GOX0459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  290633.GOX0459
Domain Number 1 Region: 387-468
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 
Weak hits

Sequence:  290633.GOX0459
Domain Number - Region: 171-382
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0217
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number - Region: 70-116
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.0659
Family Acetyl-CoA synthetase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 290633.GOX0459
Sequence length 484
Comment (Gluconobacter oxydans 621H)
Sequence
MTPALYRRQWAQNPLREVLAGMVGTFALIPEVVAFSYIAGVSPAVSLFASFVISVSIAIF
GGRPGMISGAAGSVALVAAPLVHAHGVQAMLLATLVAGAFQVVFGLLRLQAVMRFVPAEV
RTGFVNALAIMIFSAQVPQMLGVTWHTYALIALGLVIIYLLPRLSDAIPSPLICIVILTA
ITMLHPMPVHTISDLGDLPTGLPSLTFPHIALNWATWSVVLPYALAMAAVGLLESMMTAS
VVDDITDTHGDQRMECTGLGISNILVGAFGGIAGCGMIGQTVGNLRYGGRGRLSTFTAGA
FLLALMVLLHRWVGQVPMAALVAIMIMVSASTFSWSSLRDLTRHPRLSSLTMLVTVAVVV
MTHNLAAGVAVGVMLSGVFFAWHAAKLLRVTEERSGETLTYRASGQVFFASADSLSDAID
YHTDAKTVVLDLTHARFWDITSVQVLEKIIGKLQSHGHTVEVTGLHHDQHGIIASQSNES
LLAL
Download sequence
Identical sequences Q5FTQ5
gi|58038933|ref|YP_190897.1| WP_011252042.1.61435 WP_011252042.1.92951 290633.GOX0459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]