SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 291331.XOO0306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  291331.XOO0306
Domain Number 1 Region: 11-73
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000102
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 291331.XOO0306
Sequence length 96
Comment (Xanthomonas oryzae KACC10331)
Sequence
MATDTVQRTGDALVITGVLDRAAVTAIWPQAIAQLDGARTLDLAGVQRLDSAGVAMLAEL
AARLRHTGSGAVVGEASGLDELRAAYRLSPTLDFQA
Download sequence
Identical sequences A0A0U4VA49 Q5H660
291331.XOO0306 342109.XOO_0277 WP_011257254.1.100287 WP_011257254.1.101918 WP_011257254.1.10801 WP_011257254.1.11746 WP_011257254.1.11992 WP_011257254.1.12016 WP_011257254.1.12038 WP_011257254.1.12284 WP_011257254.1.12532 WP_011257254.1.13943 WP_011257254.1.15664 WP_011257254.1.16001 WP_011257254.1.19029 WP_011257254.1.19407 WP_011257254.1.19779 WP_011257254.1.20356 WP_011257254.1.21407 WP_011257254.1.22155 WP_011257254.1.22948 WP_011257254.1.2575 WP_011257254.1.27990 WP_011257254.1.28412 WP_011257254.1.29999 WP_011257254.1.30088 WP_011257254.1.3010 WP_011257254.1.32656 WP_011257254.1.34187 WP_011257254.1.34656 WP_011257254.1.34831 WP_011257254.1.353 WP_011257254.1.35359 WP_011257254.1.38499 WP_011257254.1.40044 WP_011257254.1.40785 WP_011257254.1.41276 WP_011257254.1.42687 WP_011257254.1.42954 WP_011257254.1.43671 WP_011257254.1.44430 WP_011257254.1.45003 WP_011257254.1.4539 WP_011257254.1.46170 WP_011257254.1.47084 WP_011257254.1.47137 WP_011257254.1.48014 WP_011257254.1.49044 WP_011257254.1.49225 WP_011257254.1.49377 WP_011257254.1.50457 WP_011257254.1.50569 WP_011257254.1.51059 WP_011257254.1.52109 WP_011257254.1.53330 WP_011257254.1.537 WP_011257254.1.55471 WP_011257254.1.56638 WP_011257254.1.56661 WP_011257254.1.56997 WP_011257254.1.57225 WP_011257254.1.57350 WP_011257254.1.57652 WP_011257254.1.57864 WP_011257254.1.57935 WP_011257254.1.58736 WP_011257254.1.60363 WP_011257254.1.60953 WP_011257254.1.61025 WP_011257254.1.61774 WP_011257254.1.61876 WP_011257254.1.63306 WP_011257254.1.65775 WP_011257254.1.67359 WP_011257254.1.67821 WP_011257254.1.68588 WP_011257254.1.68727 WP_011257254.1.68760 WP_011257254.1.69729 WP_011257254.1.71791 WP_011257254.1.73657 WP_011257254.1.74787 WP_011257254.1.75518 WP_011257254.1.76491 WP_011257254.1.76573 WP_011257254.1.76801 WP_011257254.1.8070 WP_011257254.1.81518 WP_011257254.1.8269 WP_011257254.1.82912 WP_011257254.1.83077 WP_011257254.1.8313 WP_011257254.1.83277 WP_011257254.1.85262 WP_011257254.1.85266 WP_011257254.1.86486 WP_011257254.1.87020 WP_011257254.1.87238 WP_011257254.1.88561 WP_011257254.1.89095 WP_011257254.1.90241 WP_011257254.1.91866 WP_011257254.1.91997 WP_011257254.1.93038 WP_011257254.1.94099 WP_011257254.1.94601 WP_011257254.1.95101 WP_011257254.1.95975 WP_011257254.1.96729 WP_011257254.1.97155 WP_011257254.1.97395 WP_011257254.1.99258 gi|84621934|ref|YP_449306.1| gi|58579929|ref|YP_198945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]