SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 291331.XOO1793 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  291331.XOO1793
Domain Number - Region: 86-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.017
Family NfeD domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 291331.XOO1793
Sequence length 192
Comment (Xanthomonas oryzae KACC10331)
Sequence
MRWDVAVWAVLALLLIAAETLVPGAFLLWMGIAAAVVCVLVLVLPDIALLVQIVAFVVLS
FVSVQVYRTWCRGKGRESDRPLLNRRAEQVIGRRVLLDQAIDDGRGRVKVDDAFWVVAGP
DLPAGTPVRIVGVDGRPCWCSRSADVRGQGTCCAANVRIVAARRSIALRHCSPISVIALL
RARRSPGAAGRG
Download sequence
Identical sequences Q5H1X4
291331.XOO1793 GO.2788 gi|58581416|ref|YP_200432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]