SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292414.TM1040_3391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292414.TM1040_3391
Domain Number 1 Region: 181-425
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.87e-106
Family D-glucarate dehydratase-like 0.00000348
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.34e-47
Family Enolase N-terminal domain-like 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 292414.TM1040_3391
Sequence length 425
Comment (Silicibacter TM1040)
Sequence
MTKITGLRTYDLRFPTSEGLDGSDAMNPDPDYSAAYVILETEGTHEGHGLTFTIGRGNEI
CIAAIKALGALVVGLDLDWIREDMGRFWRHVTGDSQLRWIGPDKGAIHLAAGAVVNAVWD
LWAKDTGKPVWRLVADMSPAEILRLIDFRYLTDVLAPEEALDLLKAAEPGKEERIARLIE
EGYPCYTTSAGWLGYSDEKLRRLCREARAAGFTHTKFKVGRDLSDDIRRLTIAREELGED
MNIMIDANQVWEVDEAIDWVNRLAFARPLFIEEPTSPDDVLGHKAIREGVAPIKVATGEM
CQNRIMFKQFIASGALDIVQIDSCRMGGLNEVLAVMLVAAKYDLPVWPHAGGVGLCEYVQ
HMSMIDYVAICGEKDSKRIEYVDHLHEHFKHPCIVTGGAYQAPHAPGFSIEMKEDTLDAF
LFSDG
Download sequence
Identical sequences Q1GLV3
292414.TM1040_3391 gi|99078367|ref|YP_611625.1|NC_008043 4ip4_A 4ip4_B 4ip5_A 4ip5_B gi|99078367|ref|YP_611625.1| WP_011537006.1.15988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]