SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292414.TM1040_3454 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292414.TM1040_3454
Domain Number 1 Region: 114-234
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-29
Family NlpC/P60 0.0067
Further Details:      
 
Weak hits

Sequence:  292414.TM1040_3454
Domain Number - Region: 25-60
Classification Level Classification E-value
Superfamily SH3-domain 0.000125
Family SH3-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 292414.TM1040_3454
Sequence length 246
Comment (Silicibacter TM1040)
Sequence
MTRARIDRPVVDLCAAPAGARDRQLLLGDTVEILATSDGWCHLRAEKDGYQGWVPGTALA
EPLTPTHWVSAPATHAYTKADFKSPDLVSLSLGSQVVVSGSEGRFAQTDQGFVPLAHLMP
LAQRASDPVAVAETLLGTPYLWGGNSRFGIDCSGLVQLSCHACAIACPGDSGPQETALGQ
TLPDGTPYERGDLLFWKGHVGWVRDPLTLLHANAFSMAVTLEPLQSAITRIAEQGDGPVT
AHKRLT
Download sequence
Identical sequences Q1GLP0
WP_011537069.1.15988 gi|99078430|ref|YP_611688.1| gi|99078430|ref|YP_611688.1|NC_008043 292414.TM1040_3454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]