SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292415.Tbd_0491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292415.Tbd_0491
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.99e-28
Family Clp protease, ClpP subunit 0.03
Further Details:      
 
Domain Number 2 Region: 375-438
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000196
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 292415.Tbd_0491
Sequence length 446
Comment (Thiobacillus denitrificans ATCC 25259)
Sequence
MAHPFRILLGLALLFVLGAPAAAATVRVLTIQGAIGPASADYLLRGIDKAIKDSAQLVVI
EMDTPGGLDTSMRDIIKAILASPVPVATYVSPRGARAASAGTYILYASHIAAMAPATNLG
AATPVELAPGGSDKPAQPAGDQAREPPGDPKMRKAVHDAAAYIRGLAELRGRNAEWAERA
VREAVSLSAPEALELKVVDLIAASIEDLLRQIDGRVVRTATGEVTLATADAQVEPVVPDW
RSRLLAVIGDPSIAYILMLLGIYGLIYEFSNPGMFFPGVVGGICLLLALFALQVMPISYA
GLALMVLGIVLMISEAFIPSFGALGLGGIVAFTIGSVMLIDTEAPGYGIPWMLVVPVALA
SALFSFFAVGMALKARSRPVVTGAEEMLGARGEVIDDMAGEGWARIHGEQWRVRSGTPLK
RGDRVRVRARHDLILEVEPDKENDHV
Download sequence
Identical sequences Q3SLG6
gi|74316509|ref|YP_314249.1| 292415.Tbd_0491 WP_011311003.1.100243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]