SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292415.Tbd_2616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292415.Tbd_2616
Domain Number 1 Region: 431-523
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-17
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 292415.Tbd_2616
Sequence length 551
Comment (Thiobacillus denitrificans ATCC 25259)
Sequence
MIAVLESWRAGLFHRRHFTRNLGAGLVVGVVALPLAMAFAIASGARPEQGIYTGIVAGLL
AALFGSSHVSISGPTGAFIVILAGITAEYGFEGLQLATLMAGLILLAMGLVKLGGIIRFI
PTPVITGFTAGIAVIIWVGQWKDFFGLQPAASGAHFHEKLGALLAALPELHLPTTLLAVG
ALAIVVLLPRFLRRIPSPLVAMLAVTAAQAYWQFDGVATIGSAFGGIPSGLPAIHLPQAS
FARVLELIGPAFTIAMLGAIESLLCAVVADGMTGSRHNPNQELVGQGIANIAAPIFGGFA
ATGAIARTATNIRNGGDSPLAGIVHALFLLAVIVSLAPLAAHIPLAALAAILFVVAWNMS
EARHFSDLLRHAPINDKALLLITFLLTVFADLVIAVNVGVLLAALLFMKRMSETVRIEGE
TPDSLAALCPVAVPSGVQIYTIDGPLFFGAAATFERTLAGLHDQAEAVIFRLGRVPFADA
TAMHALDDVVRHFRQRHIEVRVCEANPRVAHKLREFGLLARIGQQDASISVLDALAELAP
QPGTQVQAEAS
Download sequence
Identical sequences Q3SFN7
WP_011313128.1.100243 292415.Tbd_2616 gi|74318634|ref|YP_316374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]