SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292459.STH224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH224
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.12e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 292459.STH224
Sequence length 185
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MYTHEILIAGFGGQGVLTAGQLLAYAGNLEGQHVSWVPAYGPEQRGGTANCSVVISDQPV
ACPMVSEPTACIVLNQPSLEKFTPAVQPGGTLVVNTSLCTGRATRTDITVVPVPATDLAV
ELGNVRFANMIALGALLAVVPVVKVESILEVLPKVMGEDKARYIPINREALSRGMEEARR
VLAGC
Download sequence
Identical sequences Q67SY4
gi|51891362|ref|YP_074053.1| 292459.STH224 WP_011194359.1.72803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]