SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292459.STH519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH519
Domain Number 1 Region: 20-189
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.05e-22
Family Clp protease, ClpP subunit 0.029
Further Details:      
 
Weak hits

Sequence:  292459.STH519
Domain Number - Region: 364-422
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0575
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 292459.STH519
Sequence length 425
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MTLAGAPGARAENGSGKVYVLRIDNGQVIDPGLAQFADRVFDEAGADPDAVAIAVVLDTP
GGYVESAARIKDRLLHPPNGLKTIAYVENDAVSAGALIATAAEYLFMHPGAVIGAAEPRN
ALTGETADYKSLSVVVNYFTSAAEYRKRDPNIARAFVDKDHPMPWQTDVLLTLDYQKAVA
TGYANGVADSLHDAIRQAGIAQFQLVEPQWTFSEQVGRVLTTPWVAILLLVVGVIAFGIE
FMQPGLTGPAALGIVCLTLFFLGNALVGTAGWVEIALAISGLVLLGVELFTPGFGIFGLA
GIVAFGGAIFLAAPSAGLAWRYLTWTTVASAFVLFAVIRAISRRGLGKVLTLKDTAKDWS
AQAEDRARLVGREGVSLTVLRPAGTAVFDDQRLDVVTEGEFIPAGVPVKIVRVEGTRIVV
RAMAK
Download sequence
Identical sequences Q67S39
292459.STH519 gi|51891657|ref|YP_074348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]