SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 292459.STH933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH933
Domain Number 1 Region: 15-83
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000034
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 292459.STH933
Sequence length 84
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MISGCRPGVERKCHVDGQVHQVEITRIAREVTGRALTANVVALGVLNRLCRLVSDEALVE
AVLETVPRGTEAINRKALEAGMAI
Download sequence
Identical sequences Q67QX5
292459.STH933 WP_011195065.1.72803 gi|51892071|ref|YP_074762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]