SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 292459.STH953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  292459.STH953
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.42e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 292459.STH953
Sequence length 115
Comment (Symbiobacterium thermophilum IAM14863)
Sequence
MENLEQLNLIAMRIILDAGDARDFVTKAFEAMGQRDFESADEHLRAAFEKLKSAHRQQTE
VIQHEVAAGSLPPSLLFNHAQDTLMVVGSELNLARSLLAIFINIDRRLAQLEAGR
Download sequence
Identical sequences Q67QV5
gi|51892091|ref|YP_074782.1| WP_011195085.1.72803 292459.STH953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]