SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_0475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_0475
Domain Number 1 Region: 112-354
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.45e-70
Family D-glucarate dehydratase-like 0.00000167
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.1e-33
Family Enolase N-terminal domain-like 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_0475
Sequence length 363
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MKIIDIKVGRILIPLKKPFKTALRTVEHVNNIIVKIETDTGHVGYGEAPPTGVITGDTRG
SIAGAIKEHIKNNILGMDIANFEEIMIRLEKSLVKNTSAKAAVDIALYDLFGQLYNAPVY
KLLGGYRKEMTTDITVSVNDPEEMVKDSMDAVSRGFKTLKIKVGKNINLDLQRMDAIREA
VGDDIHLRLDANQGWSSKEAIYAIKKMEDKGFNIEFVEQPVKAEDLEGMKAVTENVSTLI
LADESVFSPKDAIEIIRNRAADIINIKLMKTGGIRNALRICAIAEMYGVECMIGCMLESK
LSVTAAVHLAAAKSVITKVDLDGPLLCKEDPIEGGAIFQDYKITVSDDPGFGFKNIDGII
WDS
Download sequence
Identical sequences A6TKI4
WP_011971610.1.32322 gi|150388312|ref|YP_001318361.1| 293826.Amet_0475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]