SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_1199 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_1199
Domain Number 1 Region: 197-456
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.6e-74
Family PFOR Pyr module 0.091
Further Details:      
 
Domain Number 2 Region: 5-219
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.03e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0037
Further Details:      
 
Domain Number 3 Region: 474-569
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000538
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_1199
Sequence length 573
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MPESYTLLIGGIQGEGVVSTGLNLMRSLSSLGFYTYGSRRFSSRIKGGNTSFKISISTKK
QLCTQDSVDSLFALDLETISLYENQLKEGGILLYDADLAPSFSKNSSLTYVPVPITQIAK
ESGALLMKNTCTIGFIGQLLGISEDDLIPSIKERYDKKGKQVVEKNLKVLSNSFGYKSDV
IDQHKHSLGSKPVPTSRPLMIGNEAIALGALMAGCRFIPAYPITPASEIMEYLGSVLPQY
GGVMIQVEDEISAVTMAIGASYAGVRSMTASSGPGLSLMLEGISLAGMTEVPIVVVACQR
VGPSTGLPTKHEQSDLFTLYYGGHGEYPSIILAPSTVEECFYDTIRAFNLAEEYQCPVIV
LSDLSLSLSPQTVDPLDYDQVVIQRGAMVTMDTLNHTETNDFKRFAFTENGISPRSIPGM
KNGSHHVTGVEHSENGIPNDNEKNRKKMMEKRMGKTAPLSLGSEIKIIHNNRRSTLFLTM
GSNFGIVKEAVESCGNQVDYGAITMIRPLPRKQLLEVFEKYDRVVIVENNYEGQLAAIIK
QEIGYHHKIDQFLKYDGSPFTLESLRDKIGGEA
Download sequence
Identical sequences A6TMI9
293826.Amet_1199 WP_012062448.1.32322 gi|150389017|ref|YP_001319066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]