SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_3038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_3038
Domain Number 1 Region: 9-193
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.94e-26
Family Biotin dependent carboxylase carboxyltransferase domain 0.064
Further Details:      
 
Domain Number 2 Region: 369-431
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000109
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_3038
Sequence length 432
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MRKRERFLIAILLIFAGLIMHTTAAPQEKIVYVIPIHGEIGPAVYQYMLDNLKVAEQDPN
TVAVVFEIDTYGGRVDSAERMSYYIRNSSVPTISFVNTKAESAGVLLTISADQVAMAQGS
TIGSAEPIPNTEKSLSYWVSELRTVAQQKGRDDQLVAAMADESIAIENVIESGRLLNLTN
QEALKLGLADLVAADTLAVLEGLNVEYTQIINTPMSARVRTAQLATSSVVTPILLTLGFV
GLATEVLTPGFGLGGTVSFIAFATYFGGSILAGNAGLGVIIIFMTGIALLSIEAFAPGFG
FPGIGGLIAVITSIVLAANSVTSAAVSLTIAFVLTIVAIVFILKYAPRSKHFDRIVLRTA
LTKEAGYTSFKQGSDALVGKEGVAISYLRPSGTVEVEGERLDVVSEGGFIESGSMIRVVQ
VEGRRIVVRKVE
Download sequence
Identical sequences A6TSL0
gi|150390788|ref|YP_001320837.1| WP_012064145.1.32322 293826.Amet_3038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]