SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 293826.Amet_4427 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  293826.Amet_4427
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 293826.Amet_4427
Sequence length 179
Comment (Alkaliphilus metalliredigens QYMF)
Sequence
MMDKVILAGFGGQGVMFLGKVLAYAGMGSDLELCWIPSYGPEMRGGTANCSVILSDEEIY
SPVIDFADGAIVLNKPAYDKFAPRIKPGGILVVNSSLAELEDMRDDIKIIQIPATDIANE
MGNSSIANMVCLGALLPYLNLVDLDKVKKAMDSLTKKRPQLLAVNVDAVNKGIEFIQGQ
Download sequence
Identical sequences A6TWD1
WP_012065391.1.32322 293826.Amet_4427 gi|150392109|ref|YP_001322158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]