SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.B1N3V4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.B1N3V4
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000011
Family Canonical RBD 0.02
Further Details:      
 
Domain Number 2 Region: 61-88
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000227
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.B1N3V4
Sequence length 190
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MRESDVREMFSKYTKIERIDIKTGFCFVVCETEEDAKKIIDLSQTTPFMFRDKKINIELS
KQNNSNKECYICHQQGHIARNCPKQSGRRYERNRPRRRRSRSRSPNIRNRNRSPNSRSRS
PNSRSRSPNSRSRSPNSRSRSPSRRRYRKSTSFKRRYSSRSRSRSNSRRRSYSRSRSNSR
SYSQRSQHND
Download sequence
Identical sequences B1N3V4 M3TLP0 N9TDX3
XP_001913871.1.49425 gi|169801537|gb|EDS89354.1| gi|183233517|ref|XP_001913871.1| 294381.B1N3V4 jCVI|EHI_129760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]