SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4LSN8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LSN8
Domain Number 1 Region: 135-228
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-20
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 238-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000436
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LSN8
Sequence length 301
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSSSEEKSIESEEVKEEVKEEVEKKDKKDKKDKKEKKEKKEKKDKKEKKEKKHKKDKKEK
KEHKHHHHSKKEEEEKKEEEEEKKEESKMEEEHSKEEKEDESHSEEEKEENQSEEEKEKK
EEKKDNETKEFIPVEDVKLVSVFVKNIPYGWATNDMYQYFASSGPVKTRVITNKETGKSR
GFGYLDFVDLEAANKFVEEHQGEEVDGRPLFLDLADGKKGGDKDNNGGKFGAFGSSNKTG
KQHTYKGKQGGDNVCFNCGKPGHMSRECPEPRKDNRKGGFKRSFNENKTETKNDPKHIRF
D
Download sequence
Identical sequences A0A175JD81 C4LSN8 M2S6M7 N9T8X4
294381.C4LSN8 XP_657381.1.49425 jCVI|EHI_151990 gi|56474635|gb|EAL51997.1| gi|67484322|ref|XP_657381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]