SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LUS0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LUS0
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily EF-hand 3.39e-26
Family Calmodulin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LUS0
Sequence length 144
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MQKHNEDLKESFLLFDGDGDGYLTLNEFESLVRVLGVVMETSAIASTYNSNSKVRGMSYE
LFTSCFSQLKTKSFNKDEIKTAINVLDKDKKGFIPAIELRRILSTIGDNMEQKEITDLFT
FMGIDEQGVVKVDDFINQLMTVFK
Download sequence
Identical sequences A0A175JFN7 C4LUS0 M2RIC2 M7WV47 N9UIU7
gi|56468852|gb|EAL46660.1| gi|67472489|ref|XP_652048.1| jCVI|EHI_178540 294381.C4LUS0 XP_652048.1.49425 EnhiA.00230.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]