SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4LVK7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  294381.C4LVK7
Domain Number - Region: 13-34
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00293
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Domain Number - Region: 44-115
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0712
Family Actin/HSP70 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LVK7
Sequence length 153
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MPKQYSKGKSVLKKERCKNCGSSEHTTKDCLERPKKYGSKSIEMKDIQKSKSKQEEIKEL
INQTEEITKEIQNTQNRIDCKEYFNSKEEEEMIENELNKKKMAIKNLRRRDDIAPYLKDL
SDGNDKTKQEIEDMKELWDKEEDKTKRNEIEFL
Download sequence
Identical sequences A0A175JGV9 C4LVK7 M3UHC7 M7WC48 N9UVZ7
gi|56465414|gb|EAL43673.1| gi|67465783|ref|XP_649051.1| jCVI|EHI_103630 294381.C4LVK7 XP_649051.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]