SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4LYH2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4LYH2
Domain Number 1 Region: 26-116
Classification Level Classification E-value
Superfamily Histone-fold 1.49e-24
Family Nucleosome core histones 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4LYH2
Sequence length 119
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MKSLSMMPKSVKIEYCKKMGVILPEMRNRMKVEREIRELQRTTNILIPSGVFNKCVREVI
NEYTTKLFRIEKDANLALQQAAESFLVSLFQEADMMARHCKRVTILEKDMLLAMRLKSI
Download sequence
Identical sequences A0A175JK75 C4LYH2 M2S6L8
jCVI|EHI_093810 gi|56474547|gb|EAL51912.1| gi|67484142|ref|XP_657291.1| XP_657291.1.49425 294381.C4LYH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]