SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M5Z2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M5Z2
Domain Number 1 Region: 11-278
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.88e-35
Family Mycobacterial PtpB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M5Z2
Sequence length 282
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSQPRNEYWVGNIYNFRSIEDVKVKNGKIKPNHIFRGGFFFNKGEEDIKKLNSEKGICSL
VDLRSSDEVPSGFGEMVNKCGVNFYNAPLIPFWRSIFYMIFRVPFKVMVHCAYLILSAIL
TLRFHLFVGAMKSTSTSLPLGWYYPVIYHYGQKELYGLFKFIAQHSDKPFIFYCSFGKDR
TGLIGCMLEMLLGASLDECITDYKLSDRSLKDHLIVAKDHFKTFGGDEKGIDLAKTDSKL
LIDFEHFIKKKYGTIDNYLVKFVGLTQQDIETIRTNCLLRTE
Download sequence
Identical sequences A0A175JTV2 C4M5Z2 M2S531 M3TRC5 M7WIP2 N9TDR2
jCVI|EHI_181200 XP_652990.1.49425 gi|56469901|gb|EAL47604.1| gi|67474482|ref|XP_652990.1| 294381.C4M5Z2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]