SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 294381.C4M6Y1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M6Y1
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 2.4e-35
Family ATP-dependent riboflavin kinase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M6Y1
Sequence length 131
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MQTTIKGNVVKGFQRGRTIGYPTANINPTIELEQGVYYGQVKLMGKVYHAAISVGKNPTF
CLKNIVVEVHIFEQFKDEFYGEEIEVKIMKFLRGMKKVNGIDELKKMISNDCNIIENEII
PNTPLINITDF
Download sequence
Identical sequences A0A175JV61 C4M6Y1 M2QEN9 M3U370 M7WAW6 N9TNS1
294381.C4M6Y1 EnhiA.01311.a XP_650901.1.49425 jCVI|EHI_033240 gi|56467567|gb|EAL45515.1| gi|67469859|ref|XP_650901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]