SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4M7A6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M7A6
Domain Number 1 Region: 194-284
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-17
Family Canonical RBD 0.0062
Further Details:      
 
Domain Number 2 Region: 301-340
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000744
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 3 Region: 343-369
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000454
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M7A6
Sequence length 391
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSLKTPKNFKVIDVSDTESDSESSYEKHEIAKPEIKEEKEKKEEHKHSKKDKKEKKKDKK
EKKKEKDNDKEEEQKEKNTTEVTKMEEDTKEEIAKDEKEQEKNEKEESVNDKKEEQVKKE
QVKEEQVKEEQVKKEECHEEEQEELVNDKKKEEIKEEEKTQKKEIKKEEPQEEEVLKRNK
KTVKQEEKDKQKKDEGKKYISVCVQGIPKQWNTRKFREEFGDYNIAKCRIITFKGKSESR
GFGYLDFFNVNEAQRCIDEMTGKEFEGRAVYLEYANTKKKGYRHGDTSTPETASLNKSIQ
KVCFKCGKPGHIGRDCSQPDDKVCFHCGKLGHIGKNCPEQEVPESSDQVTCYKCGQVGHK
SVDCPENTEGGFKRKSNDNTEDTGKHIRFDD
Download sequence
Identical sequences A0A175JVA5 C4M7A6 M3UV33 M7XAZ5 N9TKG8
gi|56468849|gb|EAL46657.1| gi|67472483|ref|XP_652045.1| jCVI|EHI_055640 XP_652045.1.49425 294381.C4M7A6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]