SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4M917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4M917
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.06e-17
Family Canonical RBD 0.0059
Further Details:      
 
Domain Number 2 Region: 81-98
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 294381.C4M917
Sequence length 220
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MSSIKLYVGHLPDGVTQEEMNDAFSKYGSIETIDIKSHFGFVTFTNAEDGKKIIDDKIDI
TIKGRHVSVEQARGDRSRENDVCYLCGKTGHWARDCKEKRYRRRNRSSSRRRRYSRRYSS
RSRSRSPYSRRHSRSSSRRHRHSSSRSDSRSRSRSPYSRHSQRYSRHRHRSDSSSSFSRS
SPSPKRDSSKRENRSIKNEDKSIKKDTETIIQKDSENQQK
Download sequence
Identical sequences A0A175JXE3 C4M917 M3UIG2 M7WKC1 N9TMU0
jCVI|EHI_192780 gi|56465579|gb|EAL43816.1| gi|67466087|ref|XP_649199.1| 294381.C4M917 XP_649199.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]