SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4MAK5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4MAK5
Domain Number 1 Region: 138-230
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000149
Family Canonical RBD 0.0047
Further Details:      
 
Domain Number 2 Region: 89-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000837
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 294381.C4MAK5
Sequence length 232
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MPKEGLSVLTEKQLAFFFPKEEEETNGDEIIIKRIYAISENVERRKNIQKFTKLEVPSDS
EDIVLVFPSQIAQAELAEQEVDEEEVKKSEEDVICSGCGEKGHFFFNCPHKDSRKVSSEP
QQKAADPNIYVPVHMRRQADGDYNPDVSIRLSNIPASVDETVIKALYHKVVGNEKEILRI
FFPKDYVTGERRDYCFINVSTKEIAQNAISKLDGYLLEYAKLACAISKKRQN
Download sequence
Identical sequences A0A175JZN6 C4MAK5 M2RQC6 M3U3W5 N9URR5
294381.C4MAK5 jCVI|EHI_017030 XP_651234.1.49425 gi|56467946|gb|EAL45848.1| gi|67470540|ref|XP_651234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]