SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 294381.C4MBT7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  294381.C4MBT7
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000186
Family Canonical RBD 0.028
Further Details:      
 
Weak hits

Sequence:  294381.C4MBT7
Domain Number - Region: 68-86
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000663
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 294381.C4MBT7
Sequence length 220
Comment (Entamoeba histolytica HM-1:IMSS)
Sequence
MRESDVREMFSKYTKIERIDIKTGFCFVVCETEEDAKKIIDLSQTTPFMFRDKKINIELS
KQNNSNKECYICHQQGHIARNCPKQSGRRYERNRPRRRRSRSRSPNIRNRNRSPNSRSRS
PNSRSRSPNSRSRSPNSRSRSPNSRSRSPNSRSSSPGIRNRNRSPNSRSRSPSRRRYRKS
TSFKRRYSSRSRSRSNSRRRSYSRSRSNSRSYSQRSQHND
Download sequence
Identical sequences A0A175K2C6 C4MBT7 N9UYG3
294381.C4MBT7 jCVI|EHI_182360 XP_651801.2.49425 gi|169799017|gb|EAL46414.2| gi|183237523|ref|XP_651801.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]